tcp_wrappers
Wietse Venema's network logger, also known as TCPD or LOG_TCP. These programs log the client host name of incoming telnet, ftp, rsh, rlogin, finger etc. requests. Security options are: access control per host, domain and/or service; detection of host name spoofing or host address spoofing; booby traps to implement an early-warning system. The current version supports the System V.4 TLI network programming interface (Solaris, DG/UX) in addition to the traditional BSD sockets.
- Name
- tcp-wrappers
- Programs
safe_fingertcpdtcpdchktcpdmatchtry-from
- Homepage
- Version
- 7.6.q-36
- License
- Platforms
- aarch64-linux
- armv5tel-linux
- armv6l-linux
- armv7a-linux
- armv7l-linux
- i686-linux
- loongarch64-linux
- m68k-linux
- microblaze-linux
- microblazeel-linux
- mips-linux
- mips64-linux
- mips64el-linux
- mipsel-linux
- powerpc-linux
- powerpc64-linux
- powerpc64le-linux
- riscv32-linux
- riscv64-linux
- s390-linux
- s390x-linux
- x86_64-linux
- Defined
- Source